PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ZF-HD
Protein Properties Length: 250aa    MW: 27439.4 Da    PI: 7.9554
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-411PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.72.4e-324399360
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 ++rY+eClkNhA+ +GghavDGCgEfm++ g+egt +alkCaAC+CHRnFHR+e e +
    Lsa010521 43 GFRYRECLKNHAVGIGGHAVDGCGEFMAA-GDEGTLDALKCAACNCHRNFHRKEIEGQ 99
                 579*************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.1E-294496IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-294596IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.264695IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-224897IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.61E-21174248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-32181249IPR009057Homeodomain-like
TIGRFAMsTIGR015651.5E-23187243IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEFDEHEEQE EEVGIQLPPG NYDGVGNSGT GREVRKSGGG GGGFRYRECL KNHAVGIGGH  60
AVDGCGEFMA AGDEGTLDAL KCAACNCHRN FHRKEIEGQQ RQHQQLQQQH QTALQHQYMT  120
PPPYYHPHHR PTGYLHMTPA PSSHHQRPLA LPSTSREDLE EISNPSSSGG GGGGGLGGGV  180
GGGSGSRKRF RTKFTQDQKD RMLAFSETLG WRIQKQDEAA VQQFCAETGV KRHVLKVWMH  240
NNKHTIGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-271882451875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266504.17e-95PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotA2Z2596e-77ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLA0A103XZF11e-122A0A103XZF1_CYNCS; Uncharacterized protein
STRINGVIT_18s0001g07140.t014e-85(Vitis vinifera)
STRINGPGSC0003DMT4000336244e-85(Solanum tuberosum)